PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.004G196500.3
Common NameB456_004G196500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 307aa    MW: 33321.6 Da    PI: 8.0241
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.004G196500.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.36.2e-1293137347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  Gorai.004G196500.3  93 PWTEEEHRMFLLGLQKLGKGDWRGISRNYVISRTPTQVASHAQKY 137
                         8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.105.3E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.40286142IPR017930Myb domain
SuperFamilySSF466896.06E-1788143IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-1989141IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.6E-1190136IPR009057Homeodomain-like
SMARTSM007171.9E-1090140IPR001005SANT/Myb domain
PfamPF002492.3E-1093137IPR001005SANT/Myb domain
CDDcd001675.75E-993138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLSQYSGS NSGAHNGNGS  60
GSPGEGPDHT DGYASEDFVP GSSSSRERKK GVPWTEEEHR MFLLGLQKLG KGDWRGISRN  120
YVISRTPTQV ASHAQKYFIR QSNVSRRKRR SSLFDIVADE SNDQLSIPPT LDEEDKSMDS  180
NNSNDGETVP PKSESSQPCY PVVYPTYFPP FFPYSLPYWM GYDTEPTKKD THEVVKPTAV  240
HSKSPINVDE LVGMSKLSLG ESIGDSGSSS LSLKLDGSSR QSAFHANPAS SGNSNMDSSG  300
NPIHAV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.28251e-158seedling
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5279681e-51HQ527968.1 Gossypium herbaceum clone NBRI_B_6345 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475875.10.0PREDICTED: myb-like protein J
SwissprotQ2V9B01e-40MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0D2R0U90.0A0A0D2R0U9_G
STRINGPOPTR_0001s15510.11e-161(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-101MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]